HORDB

ID: hor002414
Uniprot ID: P12872
Protein name: Promotilin
Gene name: MLN
Organism: Homo sapiens (Human)
Family: Motilin family
Source: Human
Expression: NA
Disease: Diseases associated with MLN include Gastroparesis and Duodenogastric Reflux.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Length: 90
Propeptide: MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
Signal peptide: MVSRKAVAALLVVHVAAMLASQTEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: MLNR
Target Unid: O43193
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002414_AF2.pdb

hor002414_ESM.pdb

Mass:	1195851	Formula:	C454H733N127O140S5
Absent amino acids:	C	Common amino acids:	E
pI:	5.22	Basic residues:	14
Polar residues:	19	Hydrophobic residues:	24
Hydrophobicity:	-84.22	Boman Index:	-20443
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	71.56
Instability Index:	5355.89	Extinction Coefficient cystines:	8480
Absorbance 280nm:	95.28